PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID maker-scaffold11291-snap-gene-0.13-mRNA-1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Fagaceae; Castanea
Family MYB_related
Protein Properties Length: 345aa    MW: 38548 Da    PI: 5.6983
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
maker-scaffold11291-snap-gene-0.13-mRNA-1genomeTHGPView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding35.72e-11119160345
                                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
                            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                                                 W  +E+ ll+++++++G g+W+ +++++g ++ + qc+++++
  maker-scaffold11291-snap-gene-0.13-mRNA-1 119 DWNVDEEMLLLEGIEMYGFGNWTEVSEHVG-TKRRSQCIDHYN 160
                                                5*****************************.9999*******8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM002914.7E-1056101IPR000433Zinc finger, ZZ-type
PfamPF005693.7E-1060100IPR000433Zinc finger, ZZ-type
CDDcd023353.38E-2660108No hitNo description
PROSITE profilePS5013510.83560103IPR000433Zinc finger, ZZ-type
SuperFamilySSF578503.06E-1560122No hitNo description
PROSITE patternPS0135706289IPR000433Zinc finger, ZZ-type
SuperFamilySSF466891.05E-11114166IPR009057Homeodomain-like
PROSITE profilePS5129319.843115167IPR017884SANT domain
SMARTSM007171.4E-10116165IPR001005SANT/Myb domain
PfamPF002491.7E-11119160IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.5E-8119161IPR009057Homeodomain-like
CDDcd001672.94E-11120160No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MGRSRAVSHL SEEDPNQRSK RKRPTTITTT TTTSNTSNAA SASNAETTET ATPTGKLALY  60
HCNYCNKDIS GRIRIKCVIC PDFDLCIECF SVGAEVTPHK SNHPYRVMDN LAFPLLCSDW  120
NVDEEMLLLE GIEMYGFGNW TEVSEHVGTK RRSQCIDHYN AVYMNSPCFP LPDMSHVMGK  180
SREELLAMSR AHGEVKKEIP NVGELTLKED SSFSARVRSD ESKEGPAWQS SSSLTSETGK  240
GLGSSSCNTF SSVIKKASNN SQIKDGIKTE EFQSDRSIGE KKPRVPGDEG PSMTELSGYN  300
FKRQEFEIEY DNDAEQILAD MEFKDTDSAA DRELKLRVLR IYSKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012071741.10.0PREDICTED: transcriptional adapter ADA2a
RefseqXP_012071742.10.0PREDICTED: transcriptional adapter ADA2a
SwissprotQ75LL61e-139TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLA0A067KTX10.0A0A067KTX1_JATCU; Uncharacterized protein
STRINGVIT_12s0057g00920.t011e-156(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726